PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00235.1.g00210.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 334aa    MW: 36759 Da    PI: 4.2061
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00235.1.g00210.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.5e-2075128356
                                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++t+eq++ Le+ Fe+++++  e+++eLA+klg++ rqV vWFqNrRa++k
  Zpz_sc00235.1.g00210.1.sm.mkhc  75 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGMQPRQVAVWFQNRRARWK 128
                                     5678*************************************************9 PP

2HD-ZIP_I/II128.52.8e-4174165192
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+Lg+qprqvavWFqnrRAR+ktkqlE+d+++Lk++++al++e++ 
  Zpz_sc00235.1.g00210.1.sm.mkhc  74 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGMQPRQVAVWFQNRRARWKTKQLEQDFDRLKASFNALRAEHDV 152
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelk 92 
                                     L +++++Lr+++ 
  Zpz_sc00235.1.g00210.1.sm.mkhc 153 LLQDNHRLRTQVV 165
                                     *********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.22E-2068132IPR009057Homeodomain-like
PROSITE profilePS5007117.91270130IPR001356Homeobox domain
SMARTSM003891.9E-2073134IPR001356Homeobox domain
PfamPF000461.4E-1775128IPR001356Homeobox domain
CDDcd000861.46E-1975131No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2276137IPR009057Homeodomain-like
PRINTSPR000314.5E-6101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000314.5E-6110126IPR000047Helix-turn-helix motif
PfamPF021832.3E-15130172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDPGRLIFNT TGSGAGQMLF LDCGVGGPAG GMFHRGGRPV FAGGLEDGRG VKRPFFTSPD  60
ELLEEEYYDE QLPEKKRRLT PEQVHLLERS FEEENKLEPE RKTELARKLG MQPRQVAVWF  120
QNRRARWKTK QLEQDFDRLK ASFNALRAEH DVLLQDNHRL RTQVVSLTEK LQEKEDAESG  180
ASAAADAAEI TTDAKQDSLA LDAQETAAEV AFDAQQVKSE DRLSTGSDES AVGDTDALLG  240
AGGGLGTVDS SFESYFPGGD DHYNDCGMEP VDHCAAEFQS EEDDGAGSDE GCSYYADETA  300
AAVAFFVGAH AHHQVQPVDD DEDDGQISSW WMWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647837.11e-137PREDICTED: homeobox-leucine zipper protein HOX16 isoform X1
SwissprotQ6YWR41e-133HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLC0PAE81e-140C0PAE8_MAIZE; Uncharacterized protein
STRINGOB02G38180.11e-136(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-56homeobox 1